Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

Product name Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40
Reference PX-TA2056
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40
Reference PX-TA2056
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2056-50
Uniprot ID P25942
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40
Reference PX-TA2056
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade: A Promising Antibody for Targeting TNFRSF5 Dalnicastobart Biosimilar is a novel monoclonal antibody (mAb) that specifically targets the tumor necrosis factor receptor superfamily member 5 (TNFRSF5), also known as CD40. This biosimilar is being developed as a potential therapeutic agent for various inflammatory and autoimmune diseases, particularly those associated with dysregulated TNFRSF5 signaling.

Structure of Dalnicastobart Biosimilar

Dalnicastobart Biosimilar is a recombinant humanized mAb, meaning it is derived from both human and non-human sources. It is composed of two heavy chains and two light chains, each with a variable region that specifically binds to TNFRSF5. The constant regions of the antibody are modified to minimize immunogenicity and enhance stability.

The unique structure of Dalnicastobart Biosimilar allows it to bind specifically to TNFRSF5 with high affinity, blocking its interaction with its ligand, CD40L. This prevents downstream signaling events that contribute to inflammation and disease progression.

Activity of Dalnicastobart Biosimilar

TNFRSF5 is a cell surface receptor that is expressed on various immune cells, including B cells, T cells, and dendritic cells. It plays a critical role in regulating immune responses and is implicated in the pathogenesis of several autoimmune diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis.

Dalnicastobart Biosimilar acts as a potent inhibitor of TNFRSF5 signaling by binding to the receptor and blocking its interaction with CD40L. This prevents the activation of downstream signaling pathways, such as NF-κB and MAPK, which are involved in the production of pro-inflammatory cytokines and the proliferation of immune cells.

Furthermore, Dalnicastobart Biosimilar has been shown to induce apoptosis (cell death) in TNFRSF5-expressing cells, which can help eliminate self-reactive immune cells and reduce inflammation in autoimmune diseases.

Applications of Dalnicastobart Biosimilar

Dalnicastobart Biosimilar holds great promise as a potential therapeutic agent for a variety of inflammatory and autoimmune diseases. Its specific targeting of TNFRSF5 makes it a highly targeted and potentially safer alternative to non-specific immunosuppressive drugs currently used to treat these conditions.

Preclinical studies have demonstrated the efficacy of Dalnicastobart Biosimilar in animal models of rheumatoid arthritis, lupus nephritis, and multiple sclerosis. It has also shown potential in treating graft-versus-host disease, a serious complication of bone marrow transplantation.

In addition to its therapeutic potential, Dalnicastobart Biosimilar may also have diagnostic applications. It can be used as a biomarker to measure levels of TNFRSF5 in patients, providing valuable information about disease severity and response to treatment.

Conclusion

Dalnicastobart Biosimilar is a promising antibody that specifically targets TNFRSF5, a key player in inflammatory and autoimmune diseases. Its unique structure and mechanism of action make it a highly targeted and potentially safer therapeutic option for patients. With ongoing research and clinical trials, Dalnicastobart Biosimilar has the potential to improve the lives of millions of patients suffering from these debilitating conditions.

Keywords: Dalnicastobart Biosimilar, Anti-TNFRSF5 mAb, TNFRSF5, CD40, monoclonal antibody, inflammatory diseases, autoimmune diseases, immunosuppressive drugs, biomarker.

SDS-PAGE for Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

SDS-PAGE for Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products