Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Dog CD137/TNFRSF9 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dog
Uniprot ID:
A0A8C0SEC4
Molecular weight:
17.44 kDa

Original price was: $309.00.Current price is: $271.00.

50ug 12% OFF + 271 loyalty points
His Ile24–Ser166
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Dog CD137/TNFRSF9 Recombinant Protein, N-His

Dog CD137/TNFRSF9 Recombinant Protein, N-His

Product name ARO-P19387-100
Uniprot ID A0A8C0SEC4
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence IQDSCSKCPAGTFCGKNKSQICIPCPPNSFSSTSGQKACDICRQCEGVFRTKKVCSPISNAECECISGFHCLGAGCTMCEQDCKQGQELTKQGCKDCRFGTFNDQKHGICQPWTNCSLDGKSVLVNGTKESDAVCGPASAGFS
Molecular weight 17.44 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile24-Ser166
Aliases /Synonyms 4-1BB ligand receptor, CD137, CDw137, ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, TNFRSF9, Tumor necrosis factor receptor superfamily member 9
Reference ARO-P19387
Note For research use only.
Molecular Constructor
His Ile24–Ser166
Product name ARO-P19387-1MG
Uniprot ID A0A8C0SEC4
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence IQDSCSKCPAGTFCGKNKSQICIPCPPNSFSSTSGQKACDICRQCEGVFRTKKVCSPISNAECECISGFHCLGAGCTMCEQDCKQGQELTKQGCKDCRFGTFNDQKHGICQPWTNCSLDGKSVLVNGTKESDAVCGPASAGFS
Molecular weight 17.44 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile24-Ser166
Aliases /Synonyms 4-1BB ligand receptor, CD137, CDw137, ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, TNFRSF9, Tumor necrosis factor receptor superfamily member 9
Reference ARO-P19387
Note For research use only.
Molecular Constructor
His Ile24–Ser166
Product name ARO-P19387-50
Uniprot ID A0A8C0SEC4
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence IQDSCSKCPAGTFCGKNKSQICIPCPPNSFSSTSGQKACDICRQCEGVFRTKKVCSPISNAECECISGFHCLGAGCTMCEQDCKQGQELTKQGCKDCRFGTFNDQKHGICQPWTNCSLDGKSVLVNGTKESDAVCGPASAGFS
Molecular weight 17.44 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile24-Ser166
Aliases /Synonyms 4-1BB ligand receptor, CD137, CDw137, ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, TNFRSF9, Tumor necrosis factor receptor superfamily member 9
Reference ARO-P19387
Note For research use only.
Molecular Constructor
His Ile24–Ser166

There are no reviews yet.

Be the first to review “Dog CD137/TNFRSF9 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products