Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Dog
Uniprot ID:
E2RKZ5
Molecular weight:
25.94 kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Partial
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Product name Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID E2RKZ5
Uniprot link http://www.uniprot.org/uniprot/E2RKZ5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight 25.94 kDa
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference E2RKZ5
Biological activity Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference PX-P3014
Note For research use only
Molecular Constructor
Partial
Product name Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID E2RKZ5
Uniprot link http://www.uniprot.org/uniprot/E2RKZ5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight 25.94 kDa
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference E2RKZ5
Biological activity Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference PX-P3014
Note For research use only
Molecular Constructor
Partial
Product name Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID E2RKZ5
Uniprot link http://www.uniprot.org/uniprot/E2RKZ5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight 25.94 kDa
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference E2RKZ5
Biological activity Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference PX-P3014
Note For research use only
Molecular Constructor
Partial
Product name PX-P3014-1MG
Uniprot ID E2RKZ5
Uniprot link http://www.uniprot.org/uniprot/E2RKZ5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight 25.94 kDa
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference E2RKZ5
Biological activity Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference PX-P3014
Note For research use only
Molecular Constructor
Partial

General information on Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis.

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

  • Shosu K, Sakurai M, Inoue K, Nakagawa T, Sakai H, Morimoto M, Okuda M, Noguchi S, Mizuno T. Programmed Cell Death Ligand 1 Expression in Canine Cancer. In Vivo. 2016 May-Jun;30(3):195-204. PubMed PMID: 27107075.

There are no reviews yet.

Be the first to review “Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products