Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Eldelumab Biosimilar – Anti-CXCL10 mAb – Research Grade

  • PX-TA1322-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade in ELISA Assay
SDS-PAGE for Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade
Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade

Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade

Product name Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade
Uniprot ID P02778
Source CAS 946414-98-8
Species Homo sapiens
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Eldelumab,BMS-936557,MDX-1100,CXCL10,anti-CXCL10
Reference PX-TA1322
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade
Uniprot ID P02778
Source CAS 946414-98-8
Species Homo sapiens
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Eldelumab,BMS-936557,MDX-1100,CXCL10,anti-CXCL10
Reference PX-TA1322
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1322-50
Uniprot ID P02778
Source CAS 946414-98-8
Species Homo sapiens
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Eldelumab,BMS-936557,MDX-1100,CXCL10,anti-CXCL10
Reference PX-TA1322
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-CXCL10[Homo sapiens] (Eldelumab) Monoclonal Antibody

Eldelumab is a human antibody that targets IP10 (also known as CXCL10). This chemokine is expressed in cases of rheumatoid arthritis, inflammatory bowel disease and multiple sclerosis.

Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade in ELISA Assay

Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade in ELISA Assay

Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade

SDS-PAGE for Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade

Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Eldelumab Biosimilar - Anti-CXCL10 mAb - Research Grade

There are no reviews yet.

Be the first to review “Eldelumab Biosimilar – Anti-CXCL10 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products