Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Eldelumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Eldelumab ELISA Kit

Eldelumab ELISA Kit

Product name Eldelumab ELISA Kit
Uniprot ID P02778
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX139
Note For research use only.
Sample type Plasma, Serum
Target Eldelumab
Immunogen Eldelumab

Introduction

Eldelumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Eldelumab, a human monoclonal antibody. This kit is designed to accurately measure the levels of Eldelumab in various biological samples, making it an essential tool for research and clinical applications. In this article, we will discuss the structure, activity, and application of Eldelumab ELISA Kit in detail.

Structure of Eldelumab

Eldelumab is a fully human monoclonal antibody that specifically targets the interleukin-6 (IL-6) receptor. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable regions of Eldelumab bind to the IL-6 receptor, while the constant regions provide stability and effector functions.

Activity of Eldelumab

Eldelumab binds to the IL-6 receptor with high affinity and blocks the binding of IL-6 to its receptor. This prevents the activation of downstream signaling pathways, leading to the inhibition of IL-6-mediated inflammatory responses. IL-6 is a pro-inflammatory cytokine that plays a crucial role in various autoimmune and inflammatory diseases, making it a promising therapeutic target.

Application of Eldelumab ELISA Kit

1. Research: Eldelumab ELISA Kit is widely used in research to measure the levels of Eldelumab in biological samples. This helps in understanding the pharmacokinetics and pharmacodynamics of Eldelumab, which is essential for the development of new treatments.

2. Clinical trials: Eldelumab is currently being evaluated in clinical trials for the treatment of various autoimmune and inflammatory diseases, including rheumatoid arthritis, Crohn’s disease, and ulcerative colitis. The Eldelumab ELISA Kit is an essential tool for monitoring the levels of Eldelumab in patients and assessing its efficacy.

3. Diagnosis: Elevated levels of IL-6 have been linked to several diseases, including rheumatoid arthritis, systemic lupus erythematosus, and multiple myeloma. Measuring the levels of Eldelumab, which blocks the activity of IL-6, can aid in the diagnosis and monitoring of these diseases.

4. Personalized medicine: The Eldelumab ELISA Kit can also be used to determine the optimal dose of Eldelumab for individual patients. This allows for personalized treatment based on the patient’s Eldelumab levels, leading to better treatment outcomes.

5. Quality control: The Eldelumab ELISA Kit is also used for quality control purposes in the production of Eldelumab. It ensures that the levels of Eldelumab in the final product are within the desired range, ensuring its safety and efficacy.

Conclusion

In conclusion, Eldelumab ELISA Kit is a valuable tool for measuring the levels of Eldelumab in various biological samples. Its high sensitivity and specificity make it an essential tool for research and clinical applications. With the increasing interest in Eldelumab as a therapeutic target, the use of this kit is expected to grow in the future, aiding in the development of new treatments for autoimmune and inflammatory diseases.

Eldelumab ELISA Kit

There are no reviews yet.

Be the first to review “Eldelumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products