Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
C5MKY7&Q08431
Molecular weight:
27kDa&28kDa

$250.00

50ug + 250 loyalty points
Met1–Lys239 & Trp137-Cys387 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

Product name Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)
Uniprot ID C5MKY7&Q08431
Uniprot link https://www.uniprot.org/uniprot/Q08431
Expression system Prokaryotic expression
Sequence MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH
Molecular weight 27kDa&28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239 & Trp137-Cys387
Protein Accession AGT36556 & Q08431
Spec:Entrez GeneID 4240
Spec:NCBI Gene Aliases BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Reference AGT36556 & Q08431
Aliases /Synonyms Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1
Reference PX-P4698
Note For research use only
Molecular Constructor
Met1–Lys239 & Trp137-Cys387 His
Product name Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)
Uniprot ID C5MKY7&Q08431
Uniprot link https://www.uniprot.org/uniprot/Q08431
Expression system Prokaryotic expression
Sequence MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH
Molecular weight 27kDa&28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239 & Trp137-Cys387
Protein Accession AGT36556 & Q08431
Spec:Entrez GeneID 4240
Spec:NCBI Gene Aliases BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Reference AGT36556 & Q08431
Aliases /Synonyms Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1
Reference PX-P4698
Note For research use only
Molecular Constructor
Met1–Lys239 & Trp137-Cys387 His

There are no reviews yet.

Be the first to review “Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products