Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

EPO, C-Fc, recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01588
Molecular weight:
47.71 kDa

$451.00

100ug + 451 loyalty points
Ala28–Arg193 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

EPO, C-Fc, recombinant protein

Product name EPO, C-Fc, recombinant protein
Uniprot ID P01588
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Molecular weight 47.71 kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala28-Arg193
Protein Accession P01588
Reference PX-P5704
Note For research use only
Molecular Constructor
Ala28–Arg193 Fc

EPO, C-Fc, recombinant protein

There are no reviews yet.

Be the first to review “EPO, C-Fc, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products