Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Falbikitug Biosimilar – Anti-Emfilermin mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade

Product name Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade
Uniprot ID P15018
Source CAS: 2740565-02-8
Species Human
Raw Antigen Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Emfilermin, D factor, HILDA, LIF, MLPLI, Melanoma-derived LPL inhibitor, Leukemia inhibitory factor, Differentiation-stimulating factor
Reference PX-TA1947
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade
Uniprot ID P15018
Source CAS: 2740565-02-8
Species Human
Raw Antigen Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Emfilermin, D factor, HILDA, LIF, MLPLI, Melanoma-derived LPL inhibitor, Leukemia inhibitory factor, Differentiation-stimulating factor
Reference PX-TA1947
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1947-50
Uniprot ID P15018
Source CAS: 2740565-02-8
Species Human
Raw Antigen Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Emfilermin, D factor, HILDA, LIF, MLPLI, Melanoma-derived LPL inhibitor, Leukemia inhibitory factor, Differentiation-stimulating factor
Reference PX-TA1947
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Falbikitug Biosimilar is a research grade anti-Emfilermin monoclonal antibody (mAb) that has shown promising results in targeting and inhibiting the activity of Emfilermin, a cytokine involved in the development and progression of various diseases. In this article, we will provide a detailed scientific description of Falbikitug Biosimilar, including its structure, activity, and potential applications.

Structure of Falbikitug Biosimilar

Falbikitug Biosimilar is a recombinant humanized monoclonal antibody that is produced in a CHO (Chinese Hamster Ovary) cell line. It consists of two heavy chains and two light chains, each containing a variable and a constant region. The variable regions are responsible for binding to the target molecule, Emfilermin, while the constant regions provide stability and effector functions.

Activity of Falbikitug Biosimilar

Falbikitug Biosimilar specifically targets and binds to Emfilermin, a cytokine that plays a crucial role in inflammation and tissue repair. Emfilermin is known to be overexpressed in various diseases, including cancer, autoimmune disorders, and fibrotic diseases. By binding to Emfilermin, Falbikitug Biosimilar prevents its interaction with its receptors and inhibits its activity.

Mechanism of Action

Once bound to Emfilermin, Falbikitug Biosimilar triggers a series of downstream signaling events that result in the inhibition of Emfilermin-mediated inflammatory and fibrotic processes. It also promotes tissue repair by modulating the activity of immune cells and promoting the production of anti-inflammatory cytokines.

Advantages over Other Anti-Emfilermin Therapies

Falbikitug Biosimilar has several advantages over other anti-Emfilermin therapies, including its high specificity and affinity for Emfilermin, which reduces the potential for off-target effects. It is also produced using recombinant DNA technology, ensuring a consistent and reliable supply. Additionally, being a biosimilar, it is more cost-effective compared to other biologic therapies.

Potential Applications of Falbikitug Biosimilar

Falbikitug Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various diseases. Some potential applications of Falbikitug Biosimilar include:

Cancer Emfilermin has been shown to play a role in promoting tumor growth and metastasis. By inhibiting its activity, Falbikitug Biosimilar has the potential to be used as a therapeutic agent in various types of cancer, either alone or in combination with other treatments.

Autoimmune Disorders

Emfilermin is known to be involved in the development and progression of autoimmune disorders such as rheumatoid arthritis and multiple sclerosis. By targeting and inhibiting Emfilermin, Falbikitug Biosimilar has the potential to be used as a treatment for these diseases.

Fibrotic Diseases

Emfilermin has been implicated in the development of fibrotic diseases, such as idiopathic pulmonary fibrosis and liver fibrosis. By blocking its activity, Falbikitug Biosimilar has the potential to slow down or even reverse the progression of these diseases.

Future Potential

As research on Emfilermin and its role in various diseases continues, the potential applications of Falbikitug Biosimilar may expand. It may also have the potential to be used in combination with other therapies to enhance their efficacy.

Conclusion

In summary, Falbikitug Biosimilar is a research grade anti-Emfilermin monoclonal antibody that has shown promising results in targeting and inhibiting the activity of Emfilermin. With its high specificity and potential applications in various diseases, Falbikitug Biosimilar has the potential to be a valuable therapeutic option in the future. Further research and clinical trials will help to determine its full potential and benefits for patients.

SDS-PAGE for Research Grade Falbikitug

SDS-PAGE for Research Grade Falbikitug

Research Grade Falbikitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Falbikitug Biosimilar - Anti-Emfilermin mAb - Research Grade

There are no reviews yet.

Be the first to review “Falbikitug Biosimilar – Anti-Emfilermin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products