Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: $295.00.Current price is: $238.00.

100ug 19% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Felmetatug Biosimilar - Anti-VTCN1 - Research Grade

Product name PX-TA2306-100
Uniprot ID Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-VTCN1, Anti-B7-H4, Felmetatug vedotin, PF 08046048, PF-08046048, CAS: 159858-33-0
Isotype IgG
Clonality Monoclonal Antibody
Protein Name VTCN1
Product name PX-TA2306-1MG
Uniprot ID Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-VTCN1, Anti-B7-H4, Felmetatug vedotin, PF 08046048, PF-08046048, CAS: 159858-33-0
Isotype IgG
Clonality Monoclonal Antibody
Protein Name VTCN1
Product name PX-TA2306-50
Uniprot ID Q7Z7D3
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-VTCN1, Anti-B7-H4, Felmetatug vedotin, PF 08046048, PF-08046048, CAS: 159858-33-0
Isotype IgG
Clonality Monoclonal Antibody
Protein Name VTCN1

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade: A Promising Antibody Against a Key

Therapeutic Target Introduction

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade is a novel antibody that has shown great potential in the field of immunotherapy. This biosimilar is designed to target the protein VTCN1, which has been identified as a crucial therapeutic target in various diseases. In this article, we will explore the structure, activity, and potential applications of Felmetatug Biosimilar – Anti-VTCN1 – Research Grade.

Structure of Felmetatug Biosimilar – Anti-VTCN1 – Research Grade

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade is a monoclonal antibody, meaning it is produced by a single type of immune cell. It is composed of two heavy chains and two light chains, each with a specific amino acid sequence. The heavy and light chains are connected by disulfide bonds, forming the characteristic Y-shape of an antibody.

The variable regions of the antibody, located at the tips of the Y, are responsible for binding to the target protein VTCN1. These regions are highly specific and can recognize and bind to VTCN1 with high affinity, making Felmetatug Biosimilar – Anti-VTCN1 – Research Grade a potent therapeutic agent.

Activity of Felmetatug Biosimilar – Anti-VTCN1 – Research Grade

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade works by binding to VTCN1 and blocking its activity. VTCN1 is a protein that is expressed on the surface of various immune cells and has been shown to play a role in regulating immune responses. In certain diseases, such as cancer, VTCN1 can suppress the immune system and allow cancer cells to evade detection and attack.

By targeting and inhibiting VTCN1, Felmetatug Biosimilar – Anti-VTCN1 – Research Grade can help boost the body’s immune response against cancer cells. This can lead to improved outcomes for cancer patients and potentially open up new treatment options for other diseases where VTCN1 is involved.

Potential Applications

Felmetatug Biosimilar – Anti-VTCN1 – Research Grade has shown promising results in preclinical studies for various types of cancer, including breast, lung, and colon cancer. It has also shown potential in treating autoimmune diseases, where VTCN1 plays a role in suppressing the immune system.

In addition to its therapeutic potential, Felmetatug Biosimilar – Anti-VTCN1 – Research Grade can also be used in research settings to study the role of VTCN1 in various diseases. Its high specificity and potency make it a valuable tool for understanding the mechanisms of VTCN1 and its potential as a therapeutic target.

Conclusion

In summary, Felmetatug Biosimilar – Anti-VTCN1 – Research Grade is a promising antibody that targets the protein VTCN1, a key therapeutic target in various diseases. Its specific structure and activity make it a potent therapeutic agent, with potential applications in cancer treatment and autoimmune diseases. Furthermore, it can also be used as a research tool to further our understanding of VTCN1 and its role in disease. With ongoing research and development, Felmetatug Biosimilar – Anti-VTCN1 – Research Grade has the potential to improve patient outcomes and advance our knowledge in the field of immunotherapy.

SDS-PAGE for Felmetatug Biosimilar - Anti-VTCN1 - Research Grade

SDS-PAGE for Felmetatug Biosimilar - Anti-VTCN1 - Research Grade

Felmetatug Biosimilar - Anti-VTCN1 - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Felmetatug Biosimilar – Anti-VTCN1 – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products