Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human VTCN1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q7Z7D3
Molecular weight:
29 kDa

Original price was: $337.00.Current price is: $265.00.

50ug 21% OFF + 265 loyalty points
Phe29–Ala258 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human VTCN1 recombinant protein

Human VTCN1 recombinant protein

Product name PX-P6477-100
Uniprot ID Q7Z7D3
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Molecular weight 29 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe29-Ala258
Aliases /Synonyms B7 homolog 4, B7-H4, B7h.5, Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x, VTCN1, B7H4, UNQ659/PRO1291V-set domain-containing T-cell activation inhibitor 1,
Reference PX-P6477
Molecular Constructor
Phe29–Ala258 His
Product name PX-P6477-1MG
Uniprot ID Q7Z7D3
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Molecular weight 29 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe29-Ala258
Aliases /Synonyms B7 homolog 4, B7-H4, B7h.5, Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x, VTCN1, B7H4, UNQ659/PRO1291V-set domain-containing T-cell activation inhibitor 1,
Reference PX-P6477
Molecular Constructor
Phe29–Ala258 His
Product name PX-P6477-50
Uniprot ID Q7Z7D3
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Molecular weight 29 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe29-Ala258
Aliases /Synonyms B7 homolog 4, B7-H4, B7h.5, Immune costimulatory protein B7-H4, Protein B7S1, T-cell costimulatory molecule B7x, VTCN1, B7H4, UNQ659/PRO1291V-set domain-containing T-cell activation inhibitor 1,
Reference PX-P6477
Molecular Constructor
Phe29–Ala258 His

Human VTCN1 recombinant protein

There are no reviews yet.

Be the first to review “Human VTCN1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products