Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Fungus Chitinase Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Fungus
Uniprot ID:
A6Y9S8
Molecular weight:
47.19kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Fungus Chitinase Recombinant Protein

Fungus Chitinase Recombinant Protein

Product name Fungus Chitinase Recombinant Protein
Uniprot ID A6Y9S8
Uniprot link http://www.uniprot.org/uniprot/A6Y9S8
Origin species Fungus
Expression system Prokaryotic expression
Sequence MLSILKKSVALAAALQAITAFATPIANDVAIEKRASGYANAVYFTNWGIYGRNFQPADLAASDITHILYSFMNLRADG TVFSGDTYADYEKHYPSDSWNDVGNNAYGCVKQLYLLKKQNRNMKVMLSIGGWTWSTNFPAAAASAATRKTFAQSAVGFL KDWGFDGIDIDWEYPADATQAQNMVLLLQAVRDELDSYAAQYAKGHHFLLSIAAPAGPDNYNKLKLADLGKVLDYVNLMA YDFAGSWSNYTGHD
Molecular weight 47.19kDa
Protein delivered with Tag? Yes
Purity estimated 75%
Buffer PBS, pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ABQ57240.1
Spec:SwissProtID A6Y9S8
NCBI Reference ABQ57240.1
Aliases /Synonyms Chitinase, Chitinase
Reference PX-P2067
Note For research use only
Molecular Constructor
Partial Yes
Product name Fungus Chitinase Recombinant Protein
Uniprot ID A6Y9S8
Uniprot link http://www.uniprot.org/uniprot/A6Y9S8
Origin species Fungus
Expression system Prokaryotic expression
Sequence MLSILKKSVALAAALQAITAFATPIANDVAIEKRASGYANAVYFTNWGIYGRNFQPADLAASDITHILYSFMNLRADG TVFSGDTYADYEKHYPSDSWNDVGNNAYGCVKQLYLLKKQNRNMKVMLSIGGWTWSTNFPAAAASAATRKTFAQSAVGFL KDWGFDGIDIDWEYPADATQAQNMVLLLQAVRDELDSYAAQYAKGHHFLLSIAAPAGPDNYNKLKLADLGKVLDYVNLMA YDFAGSWSNYTGHD
Molecular weight 47.19kDa
Protein delivered with Tag? Yes
Purity estimated 75%
Buffer PBS, pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ABQ57240.1
Spec:SwissProtID A6Y9S8
NCBI Reference ABQ57240.1
Aliases /Synonyms Chitinase, Chitinase
Reference PX-P2067
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Fungus Chitinase Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products