Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human ACVRL1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P37023
Molecular weight:
13.67 kDa

Original price was: $403.00.Current price is: $320.00.

100ug 21% OFF + 320 loyalty points
Asp22–Gln118 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human ACVRL1 recombinant protein

Human ACVRL1 recombinant protein

Product name PX-P6524-100
Uniprot ID P37023
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 13.67 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp22-Gln118
Aliases /Synonyms ACVRL1, Activin receptor-like kinase 1, ALK-1, ACVRLK1, ALK1, SKR3, TGF-B superfamily receptor type I, TSR-ISerine/threonine-protein kinase receptor R3,
Reference PX-P6524
Molecular Constructor
Asp22–Gln118 His
Product name PX-P6524-1MG
Uniprot ID P37023
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 13.67 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp22-Gln118
Aliases /Synonyms ACVRL1, Activin receptor-like kinase 1, ALK-1, ACVRLK1, ALK1, SKR3, TGF-B superfamily receptor type I, TSR-ISerine/threonine-protein kinase receptor R3,
Reference PX-P6524
Molecular Constructor
Asp22–Gln118 His
Product name PX-P6524-50
Uniprot ID P37023
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTD
Molecular weight 13.67 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp22-Gln118
Aliases /Synonyms ACVRL1, Activin receptor-like kinase 1, ALK-1, ACVRLK1, ALK1, SKR3, TGF-B superfamily receptor type I, TSR-ISerine/threonine-protein kinase receptor R3,
Reference PX-P6524
Molecular Constructor
Asp22–Gln118 His

There are no reviews yet.

Be the first to review “Human ACVRL1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products