Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human AHSG Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P02765
Molecular weight:
38.16 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human AHSG Recombinant Protein

Human AHSG Recombinant Protein

Product name Human AHSG Recombinant Protein
Uniprot ID P02765
Uniprot link http://www.uniprot.org/uniprot/P02765
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Molecular weight 38.16 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P02765
Aliases /Synonyms HSGa, A2HS, AHS, FETUA, HSG-A2, Fetuin-A, Alpha 2-HS Glycoprotein, Fetuin A, Alpha-2-Z-Globulin, Ba-alpha-2-Glycoprotein
Reference PX-P3033
Note For research use only
Molecular Constructor
Partial Yes
Product name Human AHSG Recombinant Protein
Uniprot ID P02765
Uniprot link http://www.uniprot.org/uniprot/P02765
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Molecular weight 38.16 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P02765
Aliases /Synonyms HSGa, A2HS, AHS, FETUA, HSG-A2, Fetuin-A, Alpha 2-HS Glycoprotein, Fetuin A, Alpha-2-Z-Globulin, Ba-alpha-2-Glycoprotein
Reference PX-P3033
Note For research use only
Molecular Constructor
Partial Yes
Product name Human AHSG Recombinant Protein
Uniprot ID P02765
Uniprot link http://www.uniprot.org/uniprot/P02765
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Sequence APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Molecular weight 38.16 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P02765
Aliases /Synonyms HSGa, A2HS, AHS, FETUA, HSG-A2, Fetuin-A, Alpha 2-HS Glycoprotein, Fetuin A, Alpha-2-Z-Globulin, Ba-alpha-2-Glycoprotein
Reference PX-P3033
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human AHSG Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products