Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human ANXA5 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08758
Molecular weight:
36.74 kDa

Original price was: $315.00.Current price is: $250.00.

50ug 21% OFF + 250 loyalty points
Full-length Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human ANXA5 Recombinant Protein

Human ANXA5 Recombinant Protein

Product name Human ANXA5 Recombinant Protein
Uniprot ID P08758
Uniprot link http://www.uniprot.org/uniprot/P08758
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Molecular weight 36.74 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference P08758
Aliases /Synonyms ANX5, ENX2, PP4, PAP-I, CBP-I, Anchorin CII, Calphobindin I, Endonexin II, Lipocortin V, Placental anticoagulant protein 4, Thromboplastin inhibitor, Vascular anticoagulant-alpha
Reference PX-P3034
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human ANXA5 Recombinant Protein
Uniprot ID P08758
Uniprot link http://www.uniprot.org/uniprot/P08758
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Molecular weight 36.74 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference P08758
Aliases /Synonyms ANX5, ENX2, PP4, PAP-I, CBP-I, Anchorin CII, Calphobindin I, Endonexin II, Lipocortin V, Placental anticoagulant protein 4, Thromboplastin inhibitor, Vascular anticoagulant-alpha
Reference PX-P3034
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P3034-1MG
Uniprot ID P08758
Uniprot link http://www.uniprot.org/uniprot/P08758
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Molecular weight 36.74 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference P08758
Aliases /Synonyms ANX5, ENX2, PP4, PAP-I, CBP-I, Anchorin CII, Calphobindin I, Endonexin II, Lipocortin V, Placental anticoagulant protein 4, Thromboplastin inhibitor, Vascular anticoagulant-alpha
Reference PX-P3034
Note For research use only
Molecular Constructor
Full-length Yes

Human ANXA5 Recombinant Protein

There are no reviews yet.

Be the first to review “Human ANXA5 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products