Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human B4GALT3 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60512
Molecular weight:
28.80 kDa

Original price was: $452.00.Current price is: $387.00.

100ug 14% OFF + 387 loyalty points
His Gly111–Asp341
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human B4GALT3 Recombinant Protein, N-His

Product name ARO-P19538-100
Uniprot ID O60512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITAD
Molecular weight 28.80 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly111-Asp341
Aliases /Synonyms B4GALT3, Beta-1,4-GalTase 3, Beta-1,4-galactosyltransferase 3, Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase, Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase, Beta4Gal-T3, EC:2.4.1.-, EC:2.4.1.275, EC:2.4.1.38, EC:2.4.1.90, N-acetyllactosamine synthase, Nal synthase, Neolactotriaosylceramide beta-1,4-galactosyltransferase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3, b4Gal-T3
Reference ARO-P19538
Note For research use only.
Molecular Constructor
His Gly111–Asp341
Product name ARO-P19538-1MG
Uniprot ID O60512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITAD
Molecular weight 28.80 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly111-Asp341
Aliases /Synonyms B4GALT3, Beta-1,4-GalTase 3, Beta-1,4-galactosyltransferase 3, Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase, Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase, Beta4Gal-T3, EC:2.4.1.-, EC:2.4.1.275, EC:2.4.1.38, EC:2.4.1.90, N-acetyllactosamine synthase, Nal synthase, Neolactotriaosylceramide beta-1,4-galactosyltransferase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3, b4Gal-T3
Reference ARO-P19538
Note For research use only.
Molecular Constructor
His Gly111–Asp341
Product name ARO-P19538-50
Uniprot ID O60512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITAD
Molecular weight 28.80 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly111-Asp341
Aliases /Synonyms B4GALT3, Beta-1,4-GalTase 3, Beta-1,4-galactosyltransferase 3, Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase, Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase, Beta4Gal-T3, EC:2.4.1.-, EC:2.4.1.275, EC:2.4.1.38, EC:2.4.1.90, N-acetyllactosamine synthase, Nal synthase, Neolactotriaosylceramide beta-1,4-galactosyltransferase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3, b4Gal-T3
Reference ARO-P19538
Note For research use only.
Molecular Constructor
His Gly111–Asp341

There are no reviews yet.

Be the first to review “Human B4GALT3 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products