Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human BMP4 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P12644
Molecular weight:
40.96 kDa

$500.00

100ug + 500 loyalty points
Fc Arg292–Arg408
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human BMP4 recombinant protein

Product name Human BMP4 recombinant protein
Uniprot ID P12644
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence RSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Molecular weight 40.96 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg292-Arg408
Aliases /Synonyms BMP2B, BMP-2B, DVR4, Bone morphogenetic protein 4, BMP-4, BMP4, Bone morphogenetic protein 2B
Reference PX-P6146
Note For research use only
Molecular Constructor
Fc Arg292–Arg408

Introduction

Human BMP4 recombinant protein is a member of the bone morphogenetic protein (BMP) family, which is a group of growth factors that play a critical role in the development and maintenance of various tissues and organs in the human body. This protein has been extensively studied and has shown promising potential as a therapeutic target for various diseases and as a valuable tool in research.

Structure of Human BMP4 Recombinant Protein

The human BMP4 recombinant protein is a homodimeric protein consisting of two identical subunits, each containing 408 amino acids. The molecular weight of the protein is approximately 46 kDa. The structure of the protein is characterized by a cystine knot motif, which is a common feature among all BMP family members. This motif is responsible for the stability and functional activity of the protein.

Activity of Human BMP4 Recombinant Protein

Human BMP4 recombinant protein is a potent inducer of bone and cartilage formation. It acts by binding to specific receptors on the surface of target cells, leading to the activation of downstream signaling pathways. This results in the expression of genes involved in bone and cartilage development, leading to the formation of new bone and cartilage tissue.

In addition to its role in bone and cartilage formation, human BMP4 recombinant protein also plays a crucial role in embryonic development. It is involved in the formation of various tissues and organs, including the heart, lungs, and nervous system. It also plays a role in cell differentiation and proliferation, making it an essential factor in tissue repair and regeneration.

Application of Human BMP4 Recombinant Protein

Therapeutic Target:
Human BMP4 recombinant protein has shown great potential as a therapeutic target for various diseases and conditions. Its role in bone and cartilage formation makes it a promising candidate for the treatment of bone disorders, such as osteoporosis and bone fractures. Studies have also shown its potential in the treatment of cartilage-related diseases, such as osteoarthritis.

Furthermore, human BMP4 recombinant protein has shown promising results in the treatment of various types of cancers. It has been found to inhibit the growth and proliferation of cancer cells, making it a potential therapeutic target for cancer treatment.

Research Use:
Human BMP4 recombinant protein is widely used in research as a tool to study various biological processes. Its ability to induce bone and cartilage formation makes it a valuable tool in studying skeletal development and diseases. It is also used in tissue engineering and regenerative medicine studies to promote the formation of new bone and cartilage tissue.

Moreover, human BMP4 recombinant protein is used in developmental biology research to study the role of BMP signaling in embryonic development. It is also utilized in stem cell research to induce the differentiation of stem cells into specific cell types.

Conclusion

In conclusion, human BMP4 recombinant protein is a crucial member of the BMP family, with a diverse range of functions in the human body. Its structure, activity, and potential applications make it a valuable therapeutic target for various diseases and a valuable tool in research. Further studies and advancements in this field are expected to uncover more potential uses for this protein, making it an essential player in the field of biomedicine.

SDS-PAGE for Human BMP4 recombinant protein

SDS-PAGE for Human BMP4 recombinant protein

Human BMP4 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human BMP4 recombinant protein

There are no reviews yet.

Be the first to review “Human BMP4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products