Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human C4orf48 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q5BLP8
Molecular weight:
12.93 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Glu35–His95 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human C4orf48 recombinant protein

Human C4orf48 recombinant protein

Product name PX-P6545-100
Uniprot ID Q5BLP8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Molecular weight 12.93 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu35-His95
Aliases /Synonyms C4orf48Neuropeptide-like protein C4orf48,
Reference PX-P6545
Molecular Constructor
Glu35–His95 His
Product name PX-P6545-1MG
Uniprot ID Q5BLP8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Molecular weight 12.93 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu35-His95
Aliases /Synonyms C4orf48Neuropeptide-like protein C4orf48,
Reference PX-P6545
Molecular Constructor
Glu35–His95 His
Product name PX-P6545-50
Uniprot ID Q5BLP8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Molecular weight 12.93 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu35-His95
Aliases /Synonyms C4orf48Neuropeptide-like protein C4orf48,
Reference PX-P6545
Molecular Constructor
Glu35–His95 His

There are no reviews yet.

Be the first to review “Human C4orf48 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products