Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CALCB recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P10092
Molecular weight:
39 kDa

Original price was: $403.00.Current price is: $315.00.

50ug 22% OFF + 315 loyalty points
Met1–Phe118 Fc
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CALCB recombinant protein

Human CALCB recombinant protein

Product name PX-P6532-100
Uniprot ID P10092
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Molecular weight 39 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Phe118
Aliases /Synonyms CALCB, Calcitonin gene-related peptide 2, Beta-CGRP, CALC2, CGRP-II, Beta-type CGRPCalcitonin gene-related peptide II,
Reference PX-P6532
Molecular Constructor
Met1–Phe118 Fc
Product name PX-P6532-1MG
Uniprot ID P10092
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Molecular weight 39 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Phe118
Aliases /Synonyms CALCB, Calcitonin gene-related peptide 2, Beta-CGRP, CALC2, CGRP-II, Beta-type CGRPCalcitonin gene-related peptide II,
Reference PX-P6532
Molecular Constructor
Met1–Phe118 Fc
Product name PX-P6532-50
Uniprot ID P10092
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Molecular weight 39 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Phe118
Aliases /Synonyms CALCB, Calcitonin gene-related peptide 2, Beta-CGRP, CALC2, CGRP-II, Beta-type CGRPCalcitonin gene-related peptide II,
Reference PX-P6532
Molecular Constructor
Met1–Phe118 Fc

There are no reviews yet.

Be the first to review “Human CALCB recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products