Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD129/IL9R Recombinant Protein, C-Strep

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q01113
Molecular weight:
29.06 kDa

Original price was: $449.00.Current price is: $387.00.

100ug 14% OFF + 387 loyalty points
Ser41–Pro270 Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD129/IL9R Recombinant Protein, C-Strep

Product name ARO-P21082-100
Uniprot ID Q01113
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Molecular weight 29.06 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser41-Pro270
Aliases /Synonyms CD129, IL-9 receptor, IL-9R, IL9R, Interleukin-9 receptor
Reference ARO-P21082
Note For research use only.
Molecular Constructor
Ser41–Pro270 Strep
Product name ARO-P21082-1MG
Uniprot ID Q01113
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Molecular weight 29.06 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser41-Pro270
Aliases /Synonyms CD129, IL-9 receptor, IL-9R, IL9R, Interleukin-9 receptor
Reference ARO-P21082
Note For research use only.
Molecular Constructor
Ser41–Pro270 Strep
Product name ARO-P21082-50
Uniprot ID Q01113
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Molecular weight 29.06 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser41-Pro270
Aliases /Synonyms CD129, IL-9 receptor, IL-9R, IL9R, Interleukin-9 receptor
Reference ARO-P21082
Note For research use only.
Molecular Constructor
Ser41–Pro270 Strep

There are no reviews yet.

Be the first to review “Human CD129/IL9R Recombinant Protein, C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products