Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD158/KIR Monoclonal Antibody

Original price was: $200.00.Current price is: $157.00.

50ug 22% OFF + 157 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD158/KIR Monoclonal Antibody

Product name ARO-A16049-100
Uniprot ID P43626, P43627, P43632
Uniprot link P43626/P43627/P43632
Raw Antigen Sequence MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD158 antigen-like family member A, KIR2DL1, Killer cell immunoglobulin-like receptor 2DL1, Natural killer-associated transcript 1, NKAT-1, MHC class I NK cell receptor, CD158A, p58 natural killer cell receptor clones CL-42/47.11, CD158a, p58.1 MHC class-I-specific NK receptor, NKAT1, p58 NK receptor CL-42/47.11, p58 NK receptor CL-43, NKAT-6, NKAT6, MHC class I NK cell receptor, CD158 antigen-like family member B1, CD158b1, p58 natural killer cell receptor clone CL-43, Natural killer-associated transcript 6, CD158B1, KIR2DL2, Killer cell immunoglobulin-like receptor 2DL2, P58 natural killer cell receptor clones CL-39/CL-17, CD158i, MHC class I NK cell receptor, CD158I, p58 NK receptor CL-39/CL-17, NKAT8, KKA3, NKAT-8, CD158 antigen-like family member I, Killer cell immunoglobulin-like receptor 2DS4, Natural killer-associated transcript 8, KIR2DS4
Reference ARO-A16049
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD158/KIR
Clone Name NKVFS1
Protein Name CD158/KIR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16049-1MG
Uniprot ID P43626, P43627, P43632
Uniprot link P43626/P43627/P43632
Raw Antigen Sequence MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD158 antigen-like family member A, KIR2DL1, Killer cell immunoglobulin-like receptor 2DL1, Natural killer-associated transcript 1, NKAT-1, MHC class I NK cell receptor, CD158A, p58 natural killer cell receptor clones CL-42/47.11, CD158a, p58.1 MHC class-I-specific NK receptor, NKAT1, p58 NK receptor CL-42/47.11, p58 NK receptor CL-43, NKAT-6, NKAT6, MHC class I NK cell receptor, CD158 antigen-like family member B1, CD158b1, p58 natural killer cell receptor clone CL-43, Natural killer-associated transcript 6, CD158B1, KIR2DL2, Killer cell immunoglobulin-like receptor 2DL2, P58 natural killer cell receptor clones CL-39/CL-17, CD158i, MHC class I NK cell receptor, CD158I, p58 NK receptor CL-39/CL-17, NKAT8, KKA3, NKAT-8, CD158 antigen-like family member I, Killer cell immunoglobulin-like receptor 2DS4, Natural killer-associated transcript 8, KIR2DS4
Reference ARO-A16049
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD158/KIR
Clone Name NKVFS1
Protein Name CD158/KIR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16049-50
Uniprot ID P43626, P43627, P43632
Uniprot link P43626/P43627/P43632
Raw Antigen Sequence MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD158 antigen-like family member A, KIR2DL1, Killer cell immunoglobulin-like receptor 2DL1, Natural killer-associated transcript 1, NKAT-1, MHC class I NK cell receptor, CD158A, p58 natural killer cell receptor clones CL-42/47.11, CD158a, p58.1 MHC class-I-specific NK receptor, NKAT1, p58 NK receptor CL-42/47.11, p58 NK receptor CL-43, NKAT-6, NKAT6, MHC class I NK cell receptor, CD158 antigen-like family member B1, CD158b1, p58 natural killer cell receptor clone CL-43, Natural killer-associated transcript 6, CD158B1, KIR2DL2, Killer cell immunoglobulin-like receptor 2DL2, P58 natural killer cell receptor clones CL-39/CL-17, CD158i, MHC class I NK cell receptor, CD158I, p58 NK receptor CL-39/CL-17, NKAT8, KKA3, NKAT-8, CD158 antigen-like family member I, Killer cell immunoglobulin-like receptor 2DS4, Natural killer-associated transcript 8, KIR2DS4
Reference ARO-A16049
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD158/KIR
Clone Name NKVFS1
Protein Name CD158/KIR
Target species Anti-Human Monoclonal Antibody

Human CD158/KIR Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD158/KIR Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products