Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD24 Monoclonal Antibody

  • ARO-A15989-50
  • Validated ELISA FC WB

Original price was: $369.00.Current price is: $275.00.

50ug 25% OFF + 275 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human CD24 Monoclonal Antibody
Human CD24 Monoclonal Antibody
Human CD24 Monoclonal Antibody

Human CD24 Monoclonal Antibody

Product name ARO-A15989-100
Uniprot ID P25063
Uniprot link P25063
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Signal transducer CD24, CD24, CD24A, Small cell lung carcinoma cluster 4 antigen
Reference ARO-A15989
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD24
Clone Name SWA11
Protein Name CD24
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15989-1MG
Uniprot ID P25063
Uniprot link P25063
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Signal transducer CD24, CD24, CD24A, Small cell lung carcinoma cluster 4 antigen
Reference ARO-A15989
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD24
Clone Name SWA11
Protein Name CD24
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15989-50
Uniprot ID P25063
Uniprot link P25063
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Signal transducer CD24, CD24, CD24A, Small cell lung carcinoma cluster 4 antigen
Reference ARO-A15989
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD24
Clone Name SWA11
Protein Name CD24
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human CD24 Monoclonal Antibody

SDS-PAGE for Human CD24 Monoclonal Antibody

Human CD24 Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD24 Monoclonal Antibody

Human CD24 Monoclonal Antibody

Human CD24 Monoclonal Antibody can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Human CD24 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD24 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products