Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD300c Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q08708
Molecular weight:
20.75 kDa

Original price was: $322.00.Current price is: $271.00.

50ug 16% OFF + 271 loyalty points
Gly21–Arg183 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD300c Recombinant Protein, C-His

Product name ARO-P19433-100
Uniprot ID Q08708
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Molecular weight 20.75 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly21-Arg183
Aliases /Synonyms CD300 antigen-like family member C, CD300C, CD300c, CLM-6, CMRF-35, CMRF35, CMRF35-A1, CMRF35-like molecule 6, CMRF35A, CMRF35A1, IGSF16, IgSF16, Immunoglobulin superfamily member 16
Reference ARO-P19433
Note For research use only.
Molecular Constructor
Gly21–Arg183 His
Product name ARO-P19433-1MG
Uniprot ID Q08708
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Molecular weight 20.75 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly21-Arg183
Aliases /Synonyms CD300 antigen-like family member C, CD300C, CD300c, CLM-6, CMRF-35, CMRF35, CMRF35-A1, CMRF35-like molecule 6, CMRF35A, CMRF35A1, IGSF16, IgSF16, Immunoglobulin superfamily member 16
Reference ARO-P19433
Note For research use only.
Molecular Constructor
Gly21–Arg183 His
Product name ARO-P19433-50
Uniprot ID Q08708
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Molecular weight 20.75 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly21-Arg183
Aliases /Synonyms CD300 antigen-like family member C, CD300C, CD300c, CLM-6, CMRF-35, CMRF35, CMRF35-A1, CMRF35-like molecule 6, CMRF35A, CMRF35A1, IGSF16, IgSF16, Immunoglobulin superfamily member 16
Reference ARO-P19433
Note For research use only.
Molecular Constructor
Gly21–Arg183 His

There are no reviews yet.

Be the first to review “Human CD300c Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products