Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TYRP1 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P17643

Original price was: $345.00.Current price is: $271.00.

50ug 21% OFF + 271 loyalty points
Met1–Arg471 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TYRP1 Recombinant Protein, C-His

Product name ARO-P17828-100
Uniprot ID P17643
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg471
Aliases /Synonyms 5, 6-dihydroxyindole-2-carboxylic acid oxidase, DHICA oxidase, 1.14.18.-, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1, TRP, TRP-1, TRP1, TYRP1, CAS2, TYRP, TYRRP
Reference ARO-P17828
Note For research use only.
Molecular Constructor
Met1–Arg471 His
Product name ARO-P17828-1MG
Uniprot ID P17643
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg471
Aliases /Synonyms 5, 6-dihydroxyindole-2-carboxylic acid oxidase, DHICA oxidase, 1.14.18.-, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1, TRP, TRP-1, TRP1, TYRP1, CAS2, TYRP, TYRRP
Reference ARO-P17828
Note For research use only.
Molecular Constructor
Met1–Arg471 His
Product name ARO-P17828-50
Uniprot ID P17643
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg471
Aliases /Synonyms 5, 6-dihydroxyindole-2-carboxylic acid oxidase, DHICA oxidase, 1.14.18.-, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1, TRP, TRP-1, TRP1, TYRP1, CAS2, TYRP, TYRRP
Reference ARO-P17828
Note For research use only.
Molecular Constructor
Met1–Arg471 His

There are no reviews yet.

Be the first to review “Human TYRP1 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products