Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD300f-CD300LF recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8TDQ1
Molecular weight:
18.60 kDa

$500.00

100ug + 500 loyalty points
Thr20–Leu155 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD300f-CD300LF recombinant protein

Product name Human CD300f-CD300LF recombinant protein
Uniprot ID Q8TDQ1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKL
Molecular weight 18.60 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Leu155
Aliases /Synonyms CMRF35-like molecule 1, CLM-1, CD300 antigen-like family member F, Immune receptor expressed on myeloid cells 1, IREM-1, Immunoglobulin superfamily member 13, IgSF13, NK inhibitory receptor, CD300f, CD300LF, CD300F, CLM1, IGSF13, IREM1, NKIR, UNQ3105/PRO10111
Reference PX-P6243
Note For research use only
Molecular Constructor
Thr20–Leu155 His

Human CD300f-CD300LF recombinant protein

There are no reviews yet.

Be the first to review “Human CD300f-CD300LF recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products