Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD80/B7-1 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P33681
Molecular weight:
54.00 kDa

Original price was: $457.00.Current price is: $387.00.

100ug 15% OFF + 387 loyalty points
Met1–Asn242 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD80/B7-1 Recombinant Protein, C-Fc

Product name ARO-P21013-100
Uniprot ID P33681
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 54.00 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn242
Aliases /Synonyms Activation B7-1 antigen, B7, BB1, CD28LG, CD28LG1, CD80, CTLA-4 counter-receptor B7.1, LAB7, T-lymphocyte activation antigen CD80
Reference ARO-P21013
Note For research use only.
Molecular Constructor
Met1–Asn242 Fc
Product name ARO-P21013-1MG
Uniprot ID P33681
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 54.00 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn242
Aliases /Synonyms Activation B7-1 antigen, B7, BB1, CD28LG, CD28LG1, CD80, CTLA-4 counter-receptor B7.1, LAB7, T-lymphocyte activation antigen CD80
Reference ARO-P21013
Note For research use only.
Molecular Constructor
Met1–Asn242 Fc
Product name ARO-P21013-50
Uniprot ID P33681
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN
Molecular weight 54.00 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn242
Aliases /Synonyms Activation B7-1 antigen, B7, BB1, CD28LG, CD28LG1, CD80, CTLA-4 counter-receptor B7.1, LAB7, T-lymphocyte activation antigen CD80
Reference ARO-P21013
Note For research use only.
Molecular Constructor
Met1–Asn242 Fc

There are no reviews yet.

Be the first to review “Human CD80/B7-1 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products