Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD258/TNFSF14/LIGHT Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
O43557
Molecular weight:
21.11 kDa

Original price was: $307.00.Current price is: $271.00.

50ug 12% OFF + 271 loyalty points
Asp74–Val240 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD258/TNFSF14/LIGHT Recombinant Protein, C-His

Product name ARO-P20649-100
Uniprot ID O43557
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Molecular weight 21.11 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp74-Val240
Aliases /Synonyms CD258, HVEM-L, HVEML, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, LIGHT, TNFSF14, Tumor necrosis factor ligand superfamily member 14, Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form
Reference ARO-P20649
Note For research use only.
Molecular Constructor
Asp74–Val240 His
Product name ARO-P20649-1MG
Uniprot ID O43557
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Molecular weight 21.11 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp74-Val240
Aliases /Synonyms CD258, HVEM-L, HVEML, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, LIGHT, TNFSF14, Tumor necrosis factor ligand superfamily member 14, Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form
Reference ARO-P20649
Note For research use only.
Molecular Constructor
Asp74–Val240 His
Product name ARO-P20649-50
Uniprot ID O43557
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Molecular weight 21.11 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp74-Val240
Aliases /Synonyms CD258, HVEM-L, HVEML, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, LIGHT, TNFSF14, Tumor necrosis factor ligand superfamily member 14, Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form
Reference ARO-P20649
Note For research use only.
Molecular Constructor
Asp74–Val240 His

There are no reviews yet.

Be the first to review “Human CD258/TNFSF14/LIGHT Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products