Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD275/ICOSLG Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
O75144
Molecular weight:
55.02 kDa

Original price was: $437.00.Current price is: $387.00.

100ug 11% OFF + 387 loyalty points
Asp19–Ser258 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD275/ICOSLG Recombinant Protein, C-Fc

Product name ARO-P20321-100
Uniprot ID O75144
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Molecular weight 55.02 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp19-Ser258
Aliases /Synonyms B7 homolog 2, B7-H2, B7-like protein Gl50, B7-related protein 1, B7H2, B7RP-1, B7RP1, CD275, ICOS ligand, ICOSL, ICOSLG, KIAA0653
Reference ARO-P20321
Note For research use only.
Molecular Constructor
Asp19–Ser258 Fc
Product name ARO-P20321-1MG
Uniprot ID O75144
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Molecular weight 55.02 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp19-Ser258
Aliases /Synonyms B7 homolog 2, B7-H2, B7-like protein Gl50, B7-related protein 1, B7H2, B7RP-1, B7RP1, CD275, ICOS ligand, ICOSL, ICOSLG, KIAA0653
Reference ARO-P20321
Note For research use only.
Molecular Constructor
Asp19–Ser258 Fc
Product name ARO-P20321-50
Uniprot ID O75144
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Molecular weight 55.02 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp19-Ser258
Aliases /Synonyms B7 homolog 2, B7-H2, B7-like protein Gl50, B7-related protein 1, B7H2, B7RP-1, B7RP1, CD275, ICOS ligand, ICOSL, ICOSLG, KIAA0653
Reference ARO-P20321
Note For research use only.
Molecular Constructor
Asp19–Ser258 Fc

There are no reviews yet.

Be the first to review “Human CD275/ICOSLG Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products