Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Quisovalimab Biosimilar – Anti-CD258 mAb – Research Grade

  • PX-TA1785-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

Product name Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade
Uniprot ID O43557
Source CAS: 2427667-03-4
Species Homo sapiens
Raw Antigen Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Quisovalimab,AEVI-002, CERC-002, F-19, MDGN-002, SAR-252067,CD258,anti-CD258
Reference PX-TA1785
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade
Uniprot ID O43557
Source CAS: 2427667-03-4
Species Homo sapiens
Raw Antigen Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Quisovalimab,AEVI-002, CERC-002, F-19, MDGN-002, SAR-252067,CD258,anti-CD258
Reference PX-TA1785
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1785-50
Uniprot ID O43557
Source CAS: 2427667-03-4
Species Homo sapiens
Raw Antigen Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Quisovalimab,AEVI-002, CERC-002, F-19, MDGN-002, SAR-252067,CD258,anti-CD258
Reference PX-TA1785
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Quisovalimab Biosimilar, also known as Anti-CD258 mAb, is a monoclonal antibody that has been developed as a research grade therapeutic for the treatment of various diseases. This antibody specifically targets CD258, a protein that is found on the surface of certain cells and has been implicated in several pathological processes. In this article, we will discuss the structure, activity, and potential applications of Quisovalimab Biosimilar as a therapeutic agent.

Structure of Quisovalimab Biosimilar

Quisovalimab Biosimilar is a type of monoclonal antibody, which means it is derived from a single clone of immune cells. This antibody is produced using recombinant DNA technology, where the gene for the antibody is inserted into a host cell, such as Chinese hamster ovary cells, to produce large quantities of the antibody. The resulting antibody has a similar structure to the original antibody, making it a biosimilar.

The structure of Quisovalimab Biosimilar is composed of two heavy chains and two light chains, joined by disulfide bonds. The heavy chains contain a variable region, which is responsible for binding to the target protein, CD258, and a constant region, which determines the antibody’s effector function. The light chains also have a variable region and a constant region, and they contribute to the specificity of the antibody.

Activity of Quisovalimab Biosimilar

Quisovalimab Biosimilar specifically targets CD258, also known as death receptor 5 (DR5), which is a member of the tumor necrosis factor receptor superfamily. This protein is expressed on the surface of various cell types, including cancer cells and immune cells. Upon binding to CD258, Quisovalimab Biosimilar triggers a signaling cascade that leads to cell death, making it a potential therapeutic for cancer treatment.

In addition to its role in inducing cell death, Quisovalimab Biosimilar also has immunomodulatory effects. It has been shown to enhance the activity of immune cells, such as natural killer cells and T cells, which play a crucial role in fighting against cancer and other diseases. This activity of Quisovalimab Biosimilar makes it a promising candidate for combination therapy with other immunotherapies.

Applications of Quisovalimab Biosimilar

Quisovalimab Biosimilar has shown promising results in preclinical studies as a potential therapeutic for various types of cancer, including breast cancer, lung cancer, and colon cancer. It has also been investigated for its potential in treating autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, due to its immunomodulatory effects.

Furthermore, Quisovalimab Biosimilar has been evaluated as a potential therapy for viral infections, such as influenza and HIV, due to its ability to enhance immune cell activity. It has also been studied for its potential in treating graft-versus-host disease, a condition that can occur after a stem cell or bone marrow transplant.

Conclusion

In conclusion, Quisovalimab Biosimilar is a research grade monoclonal antibody that specifically targets CD258 and has shown promising results in preclinical studies as a potential therapeutic for various diseases. Its unique structure and activity make it a promising candidate for combination therapy with other treatments. Further research and clinical trials are needed to fully understand the potential of Quisovalimab Biosimilar as a therapeutic agent.

SDS-PAGE for Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

SDS-PAGE for Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade in ELISA Assay

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade in ELISA Assay

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

There are no reviews yet.

Be the first to review “Quisovalimab Biosimilar – Anti-CD258 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products