Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD89-FCAR recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P24071
Molecular weight:
26.78 kDa

$380.00

100ug + 380 loyalty points
Met1–Asn227 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD89-FCAR recombinant protein

Human CD89-FCAR recombinant protein

Product name Human CD89-FCAR recombinant protein
Uniprot ID P24071
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
Molecular weight 26.78 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn227
Aliases /Synonyms CD89, Immunoglobulin alpha Fc receptor, FCAR, IgA Fc receptor
Reference PX-P6239
Note For research use only
Molecular Constructor
Met1–Asn227 His

Human CD89-FCAR recombinant protein

There are no reviews yet.

Be the first to review “Human CD89-FCAR recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products