Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD99 Monoclonal Antibody

  • ARO-A15719-50
  • Validated FC

Original price was: $355.00.Current price is: $275.00.

50ug 23% OFF + 275 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Human CD99 Monoclonal Antibody
Flow Cytometry results for Human CD99 Monoclonal Antibody
Flow Cytometry results for Human CD99 Monoclonal Antibody
Human CD99 Monoclonal Antibody

Human CD99 Monoclonal Antibody

Product name ARO-A15719-100
Uniprot ID P14209
Uniprot link P14209
Raw Antigen Sequence MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MIC2Y, E2 antigen, MIC2X, 12E7, Protein MIC2, CD99 antigen, MIC2, T-cell surface glycoprotein E2, CD99
Reference ARO-A15719
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD99
Clone Name 1,20E+08
Protein Name CD99
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15719-1MG
Uniprot ID P14209
Uniprot link P14209
Raw Antigen Sequence MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MIC2Y, E2 antigen, MIC2X, 12E7, Protein MIC2, CD99 antigen, MIC2, T-cell surface glycoprotein E2, CD99
Reference ARO-A15719
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD99
Clone Name 1,20E+08
Protein Name CD99
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15719-50
Uniprot ID P14209
Uniprot link P14209
Raw Antigen Sequence MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MIC2Y, E2 antigen, MIC2X, 12E7, Protein MIC2, CD99 antigen, MIC2, T-cell surface glycoprotein E2, CD99
Reference ARO-A15719
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD99
Clone Name 1,20E+08
Protein Name CD99
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD99 Monoclonal Antibody

Flow Cytometry results for Human CD99 Monoclonal Antibody

Flow-cytometry using anti-human CD99 antibody.CD99 Transfected CHO cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD99 antibody monoclonal antibody (Catalog # ARO-A15719 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD99 Monoclonal Antibody

Flow Cytometry results for Human CD99 Monoclonal Antibody

Flow-cytometry using anti-human CD99 antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD99 antibody monoclonal antibody (Catalog # ARO-A15719 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD99 Monoclonal Antibody

Flow Cytometry results for Human CD99 Monoclonal Antibody

Flow-cytometry using anti-human CD99 antibody.Human peripheral blood monocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD99 antibody monoclonal antibody (Catalog # ARO-A15719 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD99 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD99 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products