Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CGA recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P01215 & P01225
Molecular weight:
39.20 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Ala25–Ser116 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CGA recombinant protein

Human CGA recombinant protein

Product name PX-P6562-100
Uniprot ID P01215 & P01225
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight 39.20 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ser116
Aliases /Synonyms Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Reference PX-P6562
Molecular Constructor
Ala25–Ser116 Fc
Product name PX-P6562-1MG
Uniprot ID P01215 & P01225
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight 39.20 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ser116
Aliases /Synonyms Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Reference PX-P6562
Molecular Constructor
Ala25–Ser116 Fc
Product name PX-P6562-50
Uniprot ID P01215 & P01225
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight 39.20 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ser116
Aliases /Synonyms Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Reference PX-P6562
Molecular Constructor
Ala25–Ser116 Fc

There are no reviews yet.

Be the first to review “Human CGA recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products