Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CLEC5A/MDL1 Monoclonal Antibody

Original price was: $507.00.Current price is: $393.00.

100ug 22% OFF + 393 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CLEC5A/MDL1 Monoclonal Antibody

Product name ARO-A16094-100
Uniprot ID Q9NY25
Uniprot link Q9NY25
Raw Antigen Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms C-type lectin superfamily member 5, C-type lectin domain family 5 member A, CLEC5A, MDL-1, CLECSF5, MDL1, Myeloid DAP12-associating lectin 1
Reference ARO-A16094
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLEC5A/MDL1
Clone Name DX246
Protein Name CLEC5A/MDL1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16094-1MG
Uniprot ID Q9NY25
Uniprot link Q9NY25
Raw Antigen Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms C-type lectin superfamily member 5, C-type lectin domain family 5 member A, CLEC5A, MDL-1, CLECSF5, MDL1, Myeloid DAP12-associating lectin 1
Reference ARO-A16094
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLEC5A/MDL1
Clone Name DX246
Protein Name CLEC5A/MDL1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16094-50
Uniprot ID Q9NY25
Uniprot link Q9NY25
Raw Antigen Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms C-type lectin superfamily member 5, C-type lectin domain family 5 member A, CLEC5A, MDL-1, CLECSF5, MDL1, Myeloid DAP12-associating lectin 1
Reference ARO-A16094
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLEC5A/MDL1
Clone Name DX246
Protein Name CLEC5A/MDL1
Target species Anti-Human Monoclonal Antibody

Human CLEC5A/MDL1 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CLEC5A/MDL1 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products