Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CLEC5A recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q9NY25
Molecular weight:
21.71 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Pro28–Lys188 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CLEC5A recombinant protein

Human CLEC5A recombinant protein

Product name PX-P6421-100
Uniprot ID Q9NY25
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Molecular weight 21.71 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro28-Lys188
Aliases /Synonyms C-type lectin superfamily member 5, Myeloid DAP12-associating lectin 1, MDL-1, CLEC5A, CLECSF5, MDL1C-type lectin domain family 5 member A,
Reference PX-P6421
Molecular Constructor
Pro28–Lys188 His
Product name PX-P6421-1MG
Uniprot ID Q9NY25
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Molecular weight 21.71 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro28-Lys188
Aliases /Synonyms C-type lectin superfamily member 5, Myeloid DAP12-associating lectin 1, MDL-1, CLEC5A, CLECSF5, MDL1C-type lectin domain family 5 member A,
Reference PX-P6421
Molecular Constructor
Pro28–Lys188 His
Product name PX-P6421-50
Uniprot ID Q9NY25
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence PQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Molecular weight 21.71 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Pro28-Lys188
Aliases /Synonyms C-type lectin superfamily member 5, Myeloid DAP12-associating lectin 1, MDL-1, CLEC5A, CLECSF5, MDL1C-type lectin domain family 5 member A,
Reference PX-P6421
Molecular Constructor
Pro28–Lys188 His

Human CLEC5A recombinant protein

There are no reviews yet.

Be the first to review “Human CLEC5A recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products