Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human eIF4G Recombinant Protein |
|---|---|
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK |
| Molecular weight | 23.49kDa |
| Protein delivered with Tag? | N-ter His&Trx Tag |
| Purity estimated | ≥95% |
| Buffer | PBS, imidazole 200mM + 50% glycérol |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Glu557~Lys646 |
| Protein Accession | EAW78268.1 |
| NCBI Reference | WP_001583586 |
| Aliases /Synonyms | EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18 |
| Reference | PX-P2069 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.