Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FBN1 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P35555
Molecular weight:
44.59 kDa

Original price was: $312.00.Current price is: $271.00.

50ug 13% OFF + 271 loyalty points
Ser2732–His2871 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FBN1 Recombinant Protein, C-Fc

Product name ARO-P21052-100
Uniprot ID P35555
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Molecular weight 44.59 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser2732-His2871
Aliases /Synonyms Asprosin, FBN, FBN1, Fibrillin-1
Reference ARO-P21052
Note For research use only.
Molecular Constructor
Ser2732–His2871 Fc
Product name ARO-P21052-1MG
Uniprot ID P35555
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Molecular weight 44.59 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser2732-His2871
Aliases /Synonyms Asprosin, FBN, FBN1, Fibrillin-1
Reference ARO-P21052
Note For research use only.
Molecular Constructor
Ser2732–His2871 Fc
Product name ARO-P21052-50
Uniprot ID P35555
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Molecular weight 44.59 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser2732-His2871
Aliases /Synonyms Asprosin, FBN, FBN1, Fibrillin-1
Reference ARO-P21052
Note For research use only.
Molecular Constructor
Ser2732–His2871 Fc

There are no reviews yet.

Be the first to review “Human FBN1 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products