Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human GFER Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55789
Molecular weight:
15.09 kDa

Original price was: $322.00.Current price is: $271.00.

50ug 16% OFF + 271 loyalty points
His Arg99–Asp205
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human GFER Recombinant Protein, N-His

Product name ARO-P21098-100
Uniprot ID P55789
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular weight 15.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Asp205
Aliases /Synonyms ALR, Augmenter of liver regeneration, EC:1.8.3.2, FAD-linked sulfhydryl oxidase ALR, GFER, HERV1, HPO, Hepatopoietin, hERV1
Reference ARO-P21098
Note For research use only.
Molecular Constructor
His Arg99–Asp205
Product name ARO-P21098-1MG
Uniprot ID P55789
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular weight 15.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Asp205
Aliases /Synonyms ALR, Augmenter of liver regeneration, EC:1.8.3.2, FAD-linked sulfhydryl oxidase ALR, GFER, HERV1, HPO, Hepatopoietin, hERV1
Reference ARO-P21098
Note For research use only.
Molecular Constructor
His Arg99–Asp205
Product name ARO-P21098-50
Uniprot ID P55789
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Molecular weight 15.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Asp205
Aliases /Synonyms ALR, Augmenter of liver regeneration, EC:1.8.3.2, FAD-linked sulfhydryl oxidase ALR, GFER, HERV1, HPO, Hepatopoietin, hERV1
Reference ARO-P21098
Note For research use only.
Molecular Constructor
His Arg99–Asp205

There are no reviews yet.

Be the first to review “Human GFER Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products