Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human GSTP1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09211
Molecular weight:
25,02 kDa

$250.00

50ug + 250 loyalty points
Full-length Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human GSTP1 Recombinant Protein

Product name Human GSTP1 Recombinant Protein
Uniprot ID P09211
Uniprot link http://www.uniprot.org/uniprot/P09211
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRAMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQS NTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVG DQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Molecular weight 25,02 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 250mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_000843.1
Spec:Entrez GeneID 2950
Spec:NCBI Gene Aliases DFN7, GST3, GSTP, HEL-S-22, FAEES3, PI
Spec:SwissProtID P09211
NCBI Reference NP_000843.1
Aliases /Synonyms GSTP1, glutathione S-transferase P
Reference PX-P1105
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human GSTP1 Recombinant Protein
Uniprot ID P09211
Uniprot link http://www.uniprot.org/uniprot/P09211
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRAMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQS NTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVG DQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Molecular weight 25,02 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 250mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_000843.1
Spec:Entrez GeneID 2950
Spec:NCBI Gene Aliases DFN7, GST3, GSTP, HEL-S-22, FAEES3, PI
Spec:SwissProtID P09211
NCBI Reference NP_000843.1
Aliases /Synonyms GSTP1, glutathione S-transferase P
Reference PX-P1105
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Human GSTP1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products