Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human H4C1 Recombinant Protein, N-GST&C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62805

Original price was: $468.00.Current price is: $387.00.

100ug 17% OFF + 387 loyalty points
GSTandC-Terminal His Asn26–Gly103
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human H4C1 Recombinant Protein, N-GST&C-His

Product name ARO-P18262-100
Uniprot ID P62805
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn26-Gly103
Aliases /Synonyms Histone H4; H4C1; H4/A; H4FA; HIST1H4A; H4C2; H4/I; H4FI; HIST1H4B; H4C3; H4/G; H4FG; HIST1H4C; H4C4; H4/B; H4FB; HIST1H4D; H4C5; H4/J; H4FJ; HIST1H4E; H4C6; H4/C; H4FC; HIST1H4F; H4C8; H4/H; H4FH; HIST1H4H; H4C9; H4/M; H4FM; HIST1H4I; H4C11; H4/E; H4FE; HIST1H4J; H4C12; H4/D; H4FD; HIST1H4K; H4C13; H4/K; H4FK; HIST1H4L; H4C14; H4/N; H4F2; H4FN; HIST2H4; HIST2H4A; H4C15; H4/O; H4FO; HIST2H4B; H4C16; H4-16; HIST4H4
Reference ARO-P18262
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Asn26–Gly103
Product name ARO-P18262-1MG
Uniprot ID P62805
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn26-Gly103
Aliases /Synonyms Histone H4; H4C1; H4/A; H4FA; HIST1H4A; H4C2; H4/I; H4FI; HIST1H4B; H4C3; H4/G; H4FG; HIST1H4C; H4C4; H4/B; H4FB; HIST1H4D; H4C5; H4/J; H4FJ; HIST1H4E; H4C6; H4/C; H4FC; HIST1H4F; H4C8; H4/H; H4FH; HIST1H4H; H4C9; H4/M; H4FM; HIST1H4I; H4C11; H4/E; H4FE; HIST1H4J; H4C12; H4/D; H4FD; HIST1H4K; H4C13; H4/K; H4FK; HIST1H4L; H4C14; H4/N; H4F2; H4FN; HIST2H4; HIST2H4A; H4C15; H4/O; H4FO; HIST2H4B; H4C16; H4-16; HIST4H4
Reference ARO-P18262
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Asn26–Gly103
Product name ARO-P18262-50
Uniprot ID P62805
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn26-Gly103
Aliases /Synonyms Histone H4; H4C1; H4/A; H4FA; HIST1H4A; H4C2; H4/I; H4FI; HIST1H4B; H4C3; H4/G; H4FG; HIST1H4C; H4C4; H4/B; H4FB; HIST1H4D; H4C5; H4/J; H4FJ; HIST1H4E; H4C6; H4/C; H4FC; HIST1H4F; H4C8; H4/H; H4FH; HIST1H4H; H4C9; H4/M; H4FM; HIST1H4I; H4C11; H4/E; H4FE; HIST1H4J; H4C12; H4/D; H4FD; HIST1H4K; H4C13; H4/K; H4FK; HIST1H4L; H4C14; H4/N; H4F2; H4FN; HIST2H4; HIST2H4A; H4C15; H4/O; H4FO; HIST2H4B; H4C16; H4-16; HIST4H4
Reference ARO-P18262
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Asn26–Gly103

There are no reviews yet.

Be the first to review “Human H4C1 Recombinant Protein, N-GST&C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products