Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9)

  • ARO-A18997-100
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: $613.00.Current price is: $451.00.

100ug 26% OFF + 451 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9) binds to Human H4C1 Recombinant Protein, N-GST&C-His in WB Assay
SDS-PAGE for Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9)

Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9)

Product name ARO-A18997-100
Uniprot ID P62805
Raw Antigen Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-H4K5acK8ac, Anti-Histone H4, Anti-Di-acetylated histone H4 Lys5/Lys8
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name H4K5acK8ac
Product name ARO-A18997-1MG
Uniprot ID P62805
Raw Antigen Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-H4K5acK8ac, Anti-Histone H4, Anti-Di-acetylated histone H4 Lys5/Lys8
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name H4K5acK8ac
Product name ARO-A18997-50
Uniprot ID P62805
Raw Antigen Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-H4K5acK8ac, Anti-Histone H4, Anti-Di-acetylated histone H4 Lys5/Lys8
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name H4K5acK8ac

Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9) binds to Human H4C1 Recombinant Protein, N-GST&C-His in WB Assay

Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9) binds to Human H4C1 Recombinant Protein, N-GST&C-His in WB Assay

Human H4C1 Recombinant Protein, N-GST&C-His(cat. No.ARO-P18262) can bind Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9)

SDS-PAGE for Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9)

Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human Di-acetylated histone H4/H4K5acK8ac Antibody (2A7D9)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products