Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human H4C1 Polyclonal Antibody

Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $193.00.Current price is: $140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human H4C1 Polyclonal Antibody

Product name ARO-A12618-100
Uniprot ID P62805
Raw Antigen Sequence NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-HIST1H4D, HIST2H4A, H4FE, H4FO, H4/D, H4/A, HIST1H4E, HIST1H4F, H4FG, HIST1H4L, H4FD, H4/H, HIST1H4B, HIST1H4I, H4FN, HIST1H4C, H4FI, H4FC, H4/C, H4/E, Histone H4, H4/G, H4/O, H4FB, H4FK, H4/M, H4/B, H4C1, HIST2H4, H4F2, HIST2H4B, HIST1H4A, HIST1H4J, H4/N, H4FH, H4/I, H4/J, H4/K, H4FJ, HIST1H4H, HIST1H4K, HIST4H4, H4FM, H4FA
Reference ARO-A12618
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human H4C1 (Asn26-Gly103).
Product name ARO-A12618-1MG
Uniprot ID P62805
Raw Antigen Sequence NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-HIST1H4D, HIST2H4A, H4FE, H4FO, H4/D, H4/A, HIST1H4E, HIST1H4F, H4FG, HIST1H4L, H4FD, H4/H, HIST1H4B, HIST1H4I, H4FN, HIST1H4C, H4FI, H4FC, H4/C, H4/E, Histone H4, H4/G, H4/O, H4FB, H4FK, H4/M, H4/B, H4C1, HIST2H4, H4F2, HIST2H4B, HIST1H4A, HIST1H4J, H4/N, H4FH, H4/I, H4/J, H4/K, H4FJ, HIST1H4H, HIST1H4K, HIST4H4, H4FM, H4FA
Reference ARO-A12618
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human H4C1 (Asn26-Gly103).
Product name ARO-A12618-50
Uniprot ID P62805
Raw Antigen Sequence NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-HIST1H4D, HIST2H4A, H4FE, H4FO, H4/D, H4/A, HIST1H4E, HIST1H4F, H4FG, HIST1H4L, H4FD, H4/H, HIST1H4B, HIST1H4I, H4FN, HIST1H4C, H4FI, H4FC, H4/C, H4/E, Histone H4, H4/G, H4/O, H4FB, H4FK, H4/M, H4/B, H4C1, HIST2H4, H4F2, HIST2H4B, HIST1H4A, HIST1H4J, H4/N, H4FH, H4/I, H4/J, H4/K, H4FJ, HIST1H4H, HIST1H4K, HIST4H4, H4FM, H4FA
Reference ARO-A12618
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human H4C1 (Asn26-Gly103).

There are no reviews yet.

Be the first to review “Anti-Human H4C1 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products