Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL2 recombinant protein (1-134)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P60568
Molecular weight:
16.48 kDa

$392.00

100 ug + 392 loyalty points
Met1–Thr134 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IL2 recombinant protein (1-134)

Human IL2 recombinant protein (1-134)

Product name Human IL2 recombinant protein (1-134)
Uniprot ID P60568
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADE
Molecular weight 16.48 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Delivery condition Blue ice (+4°)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr134
Aliases /Synonyms TCGF, Aldesleukin, T-cell growth factor, Interleukin-2, IL-2
Reference PX-P6288
Note For research use only.
Molecular Constructor
Met1–Thr134 His

Human IL2 recombinant protein (1-134)

There are no reviews yet.

Be the first to review “Human IL2 recombinant protein (1-134)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products