Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human KDM2A Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2K7
Molecular weight:
28.16 kDa

Original price was: $331.00.Current price is: $271.00.

50ug 18% OFF + 271 loyalty points
His Thr931–Ser1162
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human KDM2A Recombinant Protein, N-His

Human KDM2A Recombinant Protein, N-His

Product name ARO-P20471-100
Uniprot ID Q9Y2K7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS
Molecular weight 28.16 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr931-Ser1162
Aliases /Synonyms CXXC-type zinc finger protein 8, CXXC8, EC:1.14.11.27, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, FBL11, FBL7, FBXL11, JHDM1A, JmjC domain-containing histone demethylation protein 1A, KDM2A, KIAA1004, Lysine-specific demethylase 2A, [Histone-H3]-lysine-36 demethylase 1A
Reference ARO-P20471
Note For research use only.
Molecular Constructor
His Thr931–Ser1162
Product name ARO-P20471-1MG
Uniprot ID Q9Y2K7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS
Molecular weight 28.16 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr931-Ser1162
Aliases /Synonyms CXXC-type zinc finger protein 8, CXXC8, EC:1.14.11.27, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, FBL11, FBL7, FBXL11, JHDM1A, JmjC domain-containing histone demethylation protein 1A, KDM2A, KIAA1004, Lysine-specific demethylase 2A, [Histone-H3]-lysine-36 demethylase 1A
Reference ARO-P20471
Note For research use only.
Molecular Constructor
His Thr931–Ser1162
Product name ARO-P20471-50
Uniprot ID Q9Y2K7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS
Molecular weight 28.16 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr931-Ser1162
Aliases /Synonyms CXXC-type zinc finger protein 8, CXXC8, EC:1.14.11.27, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, FBL11, FBL7, FBXL11, JHDM1A, JmjC domain-containing histone demethylation protein 1A, KDM2A, KIAA1004, Lysine-specific demethylase 2A, [Histone-H3]-lysine-36 demethylase 1A
Reference ARO-P20471
Note For research use only.
Molecular Constructor
His Thr931–Ser1162

There are no reviews yet.

Be the first to review “Human KDM2A Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products