Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human MB recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P02144
Molecular weight:
18.09 kDa

Original price was: $496.00.Current price is: $451.00.

100ug 9% OFF + 451 loyalty points
Met1–Gly154 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human MB recombinant protein

Human MB recombinant protein

Product name PX-P6541-100
Uniprot ID P02144
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Molecular weight 18.09 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly154
Aliases /Synonyms MBMyoglobin,
Reference PX-P6541
Molecular Constructor
Met1–Gly154 His
Product name PX-P6541-1MG
Uniprot ID P02144
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Molecular weight 18.09 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly154
Aliases /Synonyms MBMyoglobin,
Reference PX-P6541
Molecular Constructor
Met1–Gly154 His
Product name PX-P6541-50
Uniprot ID P02144
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Molecular weight 18.09 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly154
Aliases /Synonyms MBMyoglobin,
Reference PX-P6541
Molecular Constructor
Met1–Gly154 His

There are no reviews yet.

Be the first to review “Human MB recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products