Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Protein S100 beta (S100B) recombinant protein

  • PX-P4007-100
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P04271
Molecular weight:
11.78kDa

Original price was: $466.00.Current price is: $392.00.

100ug 16% OFF + 392 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Protein S100 beta (S100B) recombinant protein

Product name Human Protein S100 beta (S100B) recombinant protein
Uniprot ID P04271
Uniprot link http://www.uniprot.org/uniprot/P04271
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight 11.78kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference PX-P4007
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Protein S100 beta (S100B) recombinant protein
Uniprot ID P04271
Uniprot link http://www.uniprot.org/uniprot/P04271
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight 11.78kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference PX-P4007
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P4007-1MG
Uniprot ID P04271
Uniprot link http://www.uniprot.org/uniprot/P04271
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight 11.78kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference PX-P4007
Note For research use only
Molecular Constructor
Full-length Yes

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Immobilized Human PDL1, B7-H1, CD274 recombinant protein (cat. No.PX-P4038) at 0.5µg/mL (100µL/well) can bind to Durvalumab Biosimilar - Anti-PD-L1 mAb (cat. No.PX-TA1002) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human Protein S100 beta (S100B) recombinant protein

There are no reviews yet.

Be the first to review “Human Protein S100 beta (S100B) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products