Brand: ProteoGenix

Human Protein S100 beta (S100B) recombinant protein

PX-P4007-10
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P04271
Molecular weight:: 11.78kDa

$250.00

+ 250 loyalty points

Full-length Yes

size size

50ug $250.00
100ug $392.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Human Protein S100 beta (S100B) recombinant protein

Product name	Human Protein S100 beta (S100B) recombinant protein
Uniprot ID	P04271
Uniprot link	http://www.uniprot.org/uniprot/P04271
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight	11.78kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Aliases /Synonyms	S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference	PX-P4007
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	Human Protein S100 beta (S100B) recombinant protein
Uniprot ID	P04271
Uniprot link	http://www.uniprot.org/uniprot/P04271
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight	11.78kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Aliases /Synonyms	S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference	PX-P4007
Note	For research use only
Molecular Constructor	Full-length Yes

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Immobilized Human PDL1, B7-H1, CD274 recombinant protein (cat. No.PX-P4038) at 0.5µg/mL (100µL/well) can bind to Durvalumab Biosimilar - Anti-PD-L1 mAb (cat. No.PX-TA1002) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “Human Protein S100 beta (S100B) recombinant protein”

Human Protein S100 beta (S100B) recombinant protein

Human Protein S100 beta (S100B) recombinant protein

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Related products

Hnk20Mab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Raxibacumab Biosimilar – Anti-Anthrax protective antigen mAb – Research Grade

Teprotumumab Biosimilar – Anti-IGF1R, CD221 mAb – Research Grade

Obiltoxaximab Biosimilar – Anti-Anthrax protective antigen mAb – Research Grade

Gontivimab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Suptavumab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Anti-Envelope protein E Biosimilar – Anti-Dengue virus mAb – Research Grade

Anti-Zika Virus Envelope Protein Biosimilar – Anti-Zika Virus mAb – Research Grade

Ansuvimab Biosimilar – Anti-GP1 surface protein of Ebolavirus mAb – Research Grade

Sotrovimab Biosimilar – Anti-Spike glycoprotein mAb – Research Grade

Alomfilimab Biosimilar – Anti-ICOS mAb – Research Grade

Melrilimab Biosimilar – Anti-IL1RL1 mAb – Research Grade

Mipasetamab Biosimilar – Anti-AXL mAb – Research Grade

Obrindatamab Biosimilar – Anti-CD276;CD3E mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human Protein S100 beta (S100B) recombinant protein

Specifications Human Protein S100 beta (S100B) recombinant protein

Documents

QC & Validation

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Reviews

Related products

Hnk20Mab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Raxibacumab Biosimilar – Anti-Anthrax protective antigen mAb – Research Grade

Teprotumumab Biosimilar – Anti-IGF1R, CD221 mAb – Research Grade

Obiltoxaximab Biosimilar – Anti-Anthrax protective antigen mAb – Research Grade

Gontivimab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Suptavumab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

Anti-Envelope protein E Biosimilar – Anti-Dengue virus mAb – Research Grade

Anti-Zika Virus Envelope Protein Biosimilar – Anti-Zika Virus mAb – Research Grade

Ansuvimab Biosimilar – Anti-GP1 surface protein of Ebolavirus mAb – Research Grade

Sotrovimab Biosimilar – Anti-Spike glycoprotein mAb – Research Grade

Alomfilimab Biosimilar – Anti-ICOS mAb – Research Grade

Melrilimab Biosimilar – Anti-IL1RL1 mAb – Research Grade

Mipasetamab Biosimilar – Anti-AXL mAb – Research Grade

Obrindatamab Biosimilar – Anti-CD276;CD3E mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human Protein S100 beta (S100B) recombinant protein