Brand: ProteoGenix

Human Protein S100 beta (S100B) recombinant protein

PX-P4007-100
Validated ELISA

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P04271
Molecular weight:: 11.78kDa

Original price was: $466.00.Current price is: $392.00.

100ug 16% OFF + 392 loyalty points

Full-length Yes

Size Size

50ug Original price was: $300.00.Current price is: $250.00.
100ug Original price was: $466.00.Current price is: $392.00.
1MG Original price was: $1,305.00.Current price is: $1,135.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Human Protein S100 beta (S100B) recombinant protein

Product name	Human Protein S100 beta (S100B) recombinant protein
Uniprot ID	P04271
Uniprot link	http://www.uniprot.org/uniprot/P04271
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight	11.78kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Aliases /Synonyms	S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference	PX-P4007
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	Human Protein S100 beta (S100B) recombinant protein
Uniprot ID	P04271
Uniprot link	http://www.uniprot.org/uniprot/P04271
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight	11.78kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Aliases /Synonyms	S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference	PX-P4007
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	PX-P4007-1MG
Uniprot ID	P04271
Uniprot link	http://www.uniprot.org/uniprot/P04271
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular weight	11.78kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
Aliases /Synonyms	S100-B, NEF, S100Beta, S-100 protein subunit beta
Reference	PX-P4007
Note	For research use only
Molecular Constructor	Full-length Yes

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Immobilized Human PDL1, B7-H1, CD274 recombinant protein (cat. No.PX-P4038) at 0.5µg/mL (100µL/well) can bind to Durvalumab Biosimilar - Anti-PD-L1 mAb (cat. No.PX-TA1002) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450