Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human SLC28A2 Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43868
Molecular weight:
35.99 kDa

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
GST Pro588–Ala658 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human SLC28A2 Recombinant Protein, N-GST & C-His

Human SLC28A2 Recombinant Protein, N-GST & C-His

Product name ARO-P19731-100
Uniprot ID O43868
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Molecular weight 35.99 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro588-Ala658
Aliases /Synonyms CNT 2, CNT2, Concentrative nucleoside transporter 2, Na(+)/nucleoside cotransporter 2, SLC28A2, SPNT, Sodium-coupled nucleoside transporter 2, Sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Solute carrier family 28 member 2, hCNT2
Reference ARO-P19731
Note For research use only.
Molecular Constructor
GST Pro588–Ala658 His
Product name ARO-P19731-1MG
Uniprot ID O43868
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Molecular weight 35.99 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro588-Ala658
Aliases /Synonyms CNT 2, CNT2, Concentrative nucleoside transporter 2, Na(+)/nucleoside cotransporter 2, SLC28A2, SPNT, Sodium-coupled nucleoside transporter 2, Sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Solute carrier family 28 member 2, hCNT2
Reference ARO-P19731
Note For research use only.
Molecular Constructor
GST Pro588–Ala658 His
Product name ARO-P19731-50
Uniprot ID O43868
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Molecular weight 35.99 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro588-Ala658
Aliases /Synonyms CNT 2, CNT2, Concentrative nucleoside transporter 2, Na(+)/nucleoside cotransporter 2, SLC28A2, SPNT, Sodium-coupled nucleoside transporter 2, Sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Solute carrier family 28 member 2, hCNT2
Reference ARO-P19731
Note For research use only.
Molecular Constructor
GST Pro588–Ala658 His

There are no reviews yet.

Be the first to review “Human SLC28A2 Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products