Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human SMG5 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPR3
Molecular weight:
20.46 kDa

Original price was: $503.00.Current price is: $387.00.

100ug 23% OFF + 387 loyalty points
His Met853–Gly1016
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human SMG5 Recombinant Protein, N-His

Human SMG5 Recombinant Protein, N-His

Product name ARO-P19525-100
Uniprot ID Q9UPR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG
Molecular weight 20.46 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met853-Gly1016
Aliases /Synonyms EST1-like protein B, EST1B, KIAA1089, LPTS-RP1, LPTS-interacting protein, Nonsense-mediated mRNA decay factor SMG5, SMG-5 homolog, SMG5, hSMG-5
Reference ARO-P19525
Note For research use only.
Molecular Constructor
His Met853–Gly1016
Product name ARO-P19525-1MG
Uniprot ID Q9UPR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG
Molecular weight 20.46 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met853-Gly1016
Aliases /Synonyms EST1-like protein B, EST1B, KIAA1089, LPTS-RP1, LPTS-interacting protein, Nonsense-mediated mRNA decay factor SMG5, SMG-5 homolog, SMG5, hSMG-5
Reference ARO-P19525
Note For research use only.
Molecular Constructor
His Met853–Gly1016
Product name ARO-P19525-50
Uniprot ID Q9UPR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG
Molecular weight 20.46 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met853-Gly1016
Aliases /Synonyms EST1-like protein B, EST1B, KIAA1089, LPTS-RP1, LPTS-interacting protein, Nonsense-mediated mRNA decay factor SMG5, SMG-5 homolog, SMG5, hSMG-5
Reference ARO-P19525
Note For research use only.
Molecular Constructor
His Met853–Gly1016

There are no reviews yet.

Be the first to review “Human SMG5 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products