Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human SNRPN Recombinant Protein, N-GST&C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P63162

Original price was: $468.00.Current price is: $387.00.

100ug 17% OFF + 387 loyalty points
GSTandC-Terminal His Thr2–Gly84
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human SNRPN Recombinant Protein, N-GST&C-His

Human SNRPN Recombinant Protein, N-GST&C-His

Product name ARO-P18285-100
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms Small nuclear ribonucleoprotein-associated protein N; snRNP-N; Sm protein D; Sm-D; Sm protein N; Sm-N; SmN; Tissue-specific-splicing protein; SNRPN; HCERN3; SMN
Reference ARO-P18285
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Thr2–Gly84
Product name ARO-P18285-1MG
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms Small nuclear ribonucleoprotein-associated protein N; snRNP-N; Sm protein D; Sm-D; Sm protein N; Sm-N; SmN; Tissue-specific-splicing protein; SNRPN; HCERN3; SMN
Reference ARO-P18285
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Thr2–Gly84
Product name ARO-P18285-50
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms Small nuclear ribonucleoprotein-associated protein N; snRNP-N; Sm protein D; Sm-D; Sm protein N; Sm-N; SmN; Tissue-specific-splicing protein; SNRPN; HCERN3; SMN
Reference ARO-P18285
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Thr2–Gly84

There are no reviews yet.

Be the first to review “Human SNRPN Recombinant Protein, N-GST&C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products