Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human STC1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P52823
Molecular weight:
27.98 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Val34–Ala247 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human STC1 recombinant protein

Human STC1 recombinant protein

Product name PX-P6530-100
Uniprot ID P52823
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence VAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 27.98 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val34-Ala247
Aliases /Synonyms Stanniocalcin-1, STC, STC-1STC1,
Reference PX-P6530
Molecular Constructor
Val34–Ala247 His
Product name PX-P6530-1MG
Uniprot ID P52823
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence VAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 27.98 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val34-Ala247
Aliases /Synonyms Stanniocalcin-1, STC, STC-1STC1,
Reference PX-P6530
Molecular Constructor
Val34–Ala247 His
Product name PX-P6530-50
Uniprot ID P52823
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence VAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 27.98 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val34-Ala247
Aliases /Synonyms Stanniocalcin-1, STC, STC-1STC1,
Reference PX-P6530
Molecular Constructor
Val34–Ala247 His

There are no reviews yet.

Be the first to review “Human STC1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products