Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human TACSTD2/TROP2 Monoclonal Antibody

  • ARO-A16172-100
  • Validated FC

Original price was: $491.00.Current price is: $393.00.

100ug 20% OFF + 393 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody
Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody
Human TACSTD2/TROP2 Monoclonal Antibody

Human TACSTD2/TROP2 Monoclonal Antibody

Product name ARO-A16172-100
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16172
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2
Clone Name SAA0113
Protein Name TACSTD2/TROP2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16172-1MG
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16172
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2
Clone Name SAA0113
Protein Name TACSTD2/TROP2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16172-50
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16172
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2
Clone Name SAA0113
Protein Name TACSTD2/TROP2
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human TACSTD2/TROP2 Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human TACSTD2/TROP2 Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human TACSTD2/TROP2 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human TACSTD2/TROP2 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products