Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

Original price was: $384.00.Current price is: $275.00.

50ug 28% OFF + 275 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

Product name ARO-A16169-100
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16169
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2 (TP15-4)
Clone Name TP15-4
Protein Name TACSTD2/TROP2 (TP15-4)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16169-1MG
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16169
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2 (TP15-4)
Clone Name TP15-4
Protein Name TACSTD2/TROP2 (TP15-4)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16169-50
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16169
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2 (TP15-4)
Clone Name TP15-4
Protein Name TACSTD2/TROP2 (TP15-4)
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

SDS-PAGE for Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products